DHCR24 antibody

Name DHCR24 antibody
Supplier Fitzgerald
Catalog 70R-6954
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
Purity/Format Affinity purified
Blocking Peptide DHCR24 Blocking Peptide
Description Rabbit polyclonal DHCR24 antibody raised against the middle region of DHCR24
Gene DHCR24
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.