MMEL1 antibody

Name MMEL1 antibody
Supplier Fitzgerald
Catalog 70R-6249
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
Purity/Format Affinity purified
Blocking Peptide MMEL1 Blocking Peptide
Description Rabbit polyclonal MMEL1 antibody raised against the middle region of MMEL1
Gene MMEL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.