| Name | PADI4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3322 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PADI4 Blocking Peptide |
| Description | Rabbit polyclonal PADI4 antibody raised against the middle region of PADI4 |
| Gene | PADI4 |
| Supplier Page | Shop |