Name | PIK3R5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4416 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PIK3R5 antibody was raised using the N terminal of PIK3R5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS |
Purity/Format | Affinity purified |
Blocking Peptide | PIK3R5 Blocking Peptide |
Description | Rabbit polyclonal PIK3R5 antibody raised against the N terminal of PIK3R5 |
Gene | PIK3R5 |
Supplier Page | Shop |