| Name | FADD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3423 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | FADD antibody was raised using a synthetic peptide corresponding to a region with amino acids ASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP |
| Purity/Format | Affinity purified |
| Blocking Peptide | FADD Blocking Peptide |
| Description | Rabbit polyclonal FADD antibody |
| Gene | Fadd |
| Supplier Page | Shop |