HOMER1 antibody

Name HOMER1 antibody
Supplier Fitzgerald
Catalog 70R-4096
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
Purity/Format Affinity purified
Blocking Peptide HOMER1 Blocking Peptide
Description Rabbit polyclonal HOMER1 antibody
Gene HOMER1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.