BBS4 antibody

Name BBS4 antibody
Supplier Fitzgerald
Catalog 70R-4576
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen BBS4 antibody was raised using the middle region of BBS4 corresponding to a region with amino acids LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC
Purity/Format Affinity purified
Blocking Peptide BBS4 Blocking Peptide
Description Rabbit polyclonal BBS4 antibody raised against the middle region of BBS4
Gene BBS4
Supplier Page Shop