RNF172 antibody

Name RNF172 antibody
Supplier Fitzgerald
Catalog 70R-6286
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RNF172 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP
Purity/Format Affinity purified
Blocking Peptide RNF172 Blocking Peptide
Description Rabbit polyclonal RNF172 antibody
Gene MARCH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.