Name | Coilin antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2429 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ |
Purity/Format | Affinity purified |
Blocking Peptide | Coilin Blocking Peptide |
Description | Rabbit polyclonal Coilin antibody raised against the C terminal of COIL |
Gene | COIL |
Supplier Page | Shop |