FRS3 antibody

Name FRS3 antibody
Supplier Fitzgerald
Catalog 70R-2077
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FRS3 antibody was raised using the middle region of FRS3 corresponding to a region with amino acids GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG
Purity/Format Affinity purified
Blocking Peptide FRS3 Blocking Peptide
Description Rabbit polyclonal FRS3 antibody raised against the middle region of FRS3
Gene FRS3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.