| Name | SAMD8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7056 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SAMD8 Blocking Peptide |
| Description | Rabbit polyclonal SAMD8 antibody raised against the middle region of SAMD8 |
| Gene | SAMD8 |
| Supplier Page | Shop |