ATP6V0D2 antibody

Name ATP6V0D2 antibody
Supplier Fitzgerald
Catalog 70R-2659
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI
Purity/Format Affinity purified
Blocking Peptide ATP6V0D2 Blocking Peptide
Description Rabbit polyclonal ATP6V0D2 antibody raised against the middle region of ATP6V0D2
Gene ATP6V0D1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.