| Name | H2AFY antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2114 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | H2AFY Blocking Peptide |
| Description | Rabbit polyclonal H2AFY antibody raised against the middle region of H2AFY |
| Gene | H2AFY |
| Supplier Page | Shop |