KCNK4 antibody

Name KCNK4 antibody
Supplier Fitzgerald
Catalog 70R-7446
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA
Purity/Format Affinity purified
Blocking Peptide KCNK4 Blocking Peptide
Description Rabbit polyclonal KCNK4 antibody raised against the N terminal of KCNK4
Gene KCNK4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.