| Name | DENND1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7093 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | DENND1B antibody was raised using the middle region of DENND1B corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY |
| Purity/Format | Affinity purified |
| Blocking Peptide | DENND1B Blocking Peptide |
| Description | Rabbit polyclonal DENND1B antibody raised against the middle region of DENND1B |
| Gene | DENND1B |
| Supplier Page | Shop |