C9ORF46 antibody

Name C9ORF46 antibody
Supplier Fitzgerald
Catalog 70R-6739
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C9ORF46 antibody was raised using the middle region of C9Orf46 corresponding to a region with amino acids GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Purity/Format Affinity purified
Blocking Peptide C9ORF46 Blocking Peptide
Description Rabbit polyclonal C9ORF46 antibody raised against the middle region of C9Orf46
Gene PLGRKT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.