LCP1 antibody

Name LCP1 antibody
Supplier Fitzgerald
Catalog 70R-3076
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDL
Purity/Format Affinity purified
Blocking Peptide LCP1 Blocking Peptide
Description Rabbit polyclonal LCP1 antibody
Gene LCP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.