Name | JMJD2B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2723 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK |
Purity/Format | Affinity purified |
Blocking Peptide | JMJD2B Blocking Peptide |
Description | Rabbit polyclonal JMJD2B antibody raised against the middle region of JMJD2B |
Gene | KDM4B |
Supplier Page | Shop |