Name | FEM1B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6026 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE |
Purity/Format | Affinity purified |
Blocking Peptide | FEM1B Blocking Peptide |
Description | Rabbit polyclonal FEM1B antibody |
Gene | FEM1B |
Supplier Page | Shop |