| Name | IL18RAP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1665 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | IL18RAP Blocking Peptide |
| Description | Rabbit polyclonal IL18RAP antibody raised against the N terminal of IL18RAP |
| Gene | IL18RAP |
| Supplier Page | Shop |