| Name | PRKRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5896 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKRA Blocking Peptide |
| Description | Rabbit polyclonal PRKRA antibody raised against the middle region of PRKRA |
| Gene | PRKRA |
| Supplier Page | Shop |