| Name | EXOSC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1344 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EXOSC2 Blocking Peptide |
| Description | Rabbit polyclonal EXOSC2 antibody raised against the N terminal of EXOSC2 |
| Gene | EXOSC2 |
| Supplier Page | Shop |