| Name | KCNK3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1536 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KCNK3 Blocking Peptide |
| Description | Rabbit polyclonal KCNK3 antibody raised against the C terminal of KCNK3 |
| Gene | KCNK3 |
| Supplier Page | Shop |