GCNT4 antibody

Name GCNT4 antibody
Supplier Fitzgerald
Catalog 70R-7414
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
Purity/Format Affinity purified
Blocking Peptide GCNT4 Blocking Peptide
Description Rabbit polyclonal GCNT4 antibody
Gene GCNT4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.