UGCGL1 antibody

Name UGCGL1 antibody
Supplier Fitzgerald
Catalog 70R-4490
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UGCGL1 antibody was raised using the middle region of UGCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
Purity/Format Affinity purified
Blocking Peptide UGCGL1 Blocking Peptide
Description Rabbit polyclonal UGCGL1 antibody raised against the middle region of UGCGL1
Gene UGGT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.