| Name | EIF4E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4682 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | EIF4E Blocking Peptide |
| Description | Rabbit polyclonal EIF4E antibody raised against the C terminal of EIF4E |
| Gene | PAG1 |
| Supplier Page | Shop |