EIF4E antibody

Name EIF4E antibody
Supplier Fitzgerald
Catalog 70R-4682
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Purity/Format Affinity purified
Blocking Peptide EIF4E Blocking Peptide
Description Rabbit polyclonal EIF4E antibody raised against the C terminal of EIF4E
Gene PAG1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.