| Name | RAB11B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5868 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAB11B antibody was raised using the C terminal of RAB11B corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB11B Blocking Peptide |
| Description | Rabbit polyclonal RAB11B antibody raised against the C terminal of RAB11B |
| Gene | RAB11A |
| Supplier Page | Shop |