ERCC6L antibody

Name ERCC6L antibody
Supplier Fitzgerald
Catalog 70R-3241
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
Purity/Format Affinity purified
Blocking Peptide ERCC6L Blocking Peptide
Description Rabbit polyclonal ERCC6L antibody raised against the N terminal Of Ercc6L
Gene ERCC6L
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.