Name | ERCC6L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3241 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS |
Purity/Format | Affinity purified |
Blocking Peptide | ERCC6L Blocking Peptide |
Description | Rabbit polyclonal ERCC6L antibody raised against the N terminal Of Ercc6L |
Gene | ERCC6L |
Supplier Page | Shop |