| Name | GHR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7290 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF |
| Purity/Format | Affinity purified |
| Blocking Peptide | GHR Blocking Peptide |
| Description | Rabbit polyclonal GHR antibody raised against the N terminal of GHR |
| Gene | GHR |
| Supplier Page | Shop |