| Name | LRRC8A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6392 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LRRC8A antibody was raised using the N terminal of LRRC8A corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC8A Blocking Peptide |
| Description | Rabbit polyclonal LRRC8A antibody raised against the N terminal of LRRC8A |
| Gene | LRRC8A |
| Supplier Page | Shop |