| Name | Symplekin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6031 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Symplekin antibody was raised using the middle region of SYMPK corresponding to a region with amino acids GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS |
| Purity/Format | Affinity purified |
| Blocking Peptide | Symplekin Blocking Peptide |
| Description | Rabbit polyclonal Symplekin antibody raised against the middle region of SYMPK |
| Gene | SYMPK |
| Supplier Page | Shop |