| Name | DNASE2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7162 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DNASE2B antibody was raised using the N terminal of DNASE2B corresponding to a region with amino acids EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS |
| Purity/Format | Affinity purified |
| Blocking Peptide | DNASE2B Blocking Peptide |
| Description | Rabbit polyclonal DNASE2B antibody raised against the N terminal of DNASE2B |
| Gene | DNASE2B |
| Supplier Page | Shop |