PARD6A antibody

Name PARD6A antibody
Supplier Fitzgerald
Catalog 70R-2600
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Purity/Format Affinity purified
Blocking Peptide PARD6A Blocking Peptide
Description Rabbit polyclonal PARD6A antibody
Gene PARD6A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.