| Name | TMPRSS11D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7386 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMPRSS11D antibody was raised using the middle region of TMPRSS11D corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMPRSS11D Blocking Peptide |
| Description | Rabbit polyclonal TMPRSS11D antibody raised against the middle region of TMPRSS11D |
| Gene | TMPRSS11D |
| Supplier Page | Shop |