| Name | ZNF364 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2797 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZNF364 Blocking Peptide |
| Description | Rabbit polyclonal ZNF364 antibody raised against the C terminal Of Znf364 |
| Gene | RNF115 |
| Supplier Page | Shop |