| Name | BBS5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2989 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW |
| Purity/Format | Affinity purified |
| Blocking Peptide | BBS5 Blocking Peptide |
| Description | Rabbit polyclonal BBS5 antibody raised against the middle region of BBS5 |
| Gene | BBS5 |
| Supplier Page | Shop |