SIGLEC6 antibody

Name SIGLEC6 antibody
Supplier Fitzgerald
Catalog 70R-6173
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
Purity/Format Affinity purified
Blocking Peptide SIGLEC6 Blocking Peptide
Description Rabbit polyclonal SIGLEC6 antibody raised against the N terminal of SIGLEC6
Gene SIGLEC6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.