| Name | EIF4B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1418 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | EIF4B antibody was raised using the C terminal of EIF4B corresponding to a region with amino acids NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EIF4B Blocking Peptide |
| Description | Rabbit polyclonal EIF4B antibody raised against the C terminal of EIF4B |
| Gene | EIF4B |
| Supplier Page | Shop |