Name | Mitofusin 2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6461 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Purity/Format | Affinity purified |
Blocking Peptide | Mitofusin 2 Blocking Peptide |
Description | Rabbit polyclonal Mitofusin 2 antibody raised against the C terminal of MFN2 |
Gene | MFN2 |
Supplier Page | Shop |