Mitofusin 2 antibody

Name Mitofusin 2 antibody
Supplier Fitzgerald
Catalog 70R-6461
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Purity/Format Affinity purified
Blocking Peptide Mitofusin 2 Blocking Peptide
Description Rabbit polyclonal Mitofusin 2 antibody raised against the C terminal of MFN2
Gene MFN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.