| Name | HNRPDL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1322 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HNRPDL Blocking Peptide |
| Description | Rabbit polyclonal HNRPDL antibody raised against the middle region of HNRPDL |
| Gene | HNRNPDL |
| Supplier Page | Shop |