| Name | P2RX7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1514 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | P2RX7 antibody was raised using the N terminal of P2RX7 corresponding to a region with amino acids IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | P2RX7 Blocking Peptide |
| Description | Rabbit polyclonal P2RX7 antibody raised against the N terminal of P2RX7 |
| Gene | P2RX7 |
| Supplier Page | Shop |