| Name | SAC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5971 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SAC Blocking Peptide |
| Description | Rabbit polyclonal SAC antibody raised against the N terminal Of Sac |
| Gene | ADCY10 |
| Supplier Page | Shop |