Name | LBP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5907 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV |
Purity/Format | Affinity purified |
Blocking Peptide | LBP Blocking Peptide |
Description | Rabbit polyclonal LBP antibody raised against the middle region of LBP |
Gene | LBP |
Supplier Page | Shop |