Name | ApoBEC3F antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4815 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ApoBEC3F antibody was raised using the middle region of APOBEC3F corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQ |
Purity/Format | Affinity purified |
Blocking Peptide | ApoBEC3F Blocking Peptide |
Description | Rabbit polyclonal ApoBEC3F antibody raised against the middle region of APOBEC3F |
Gene | APOBEC3F |
Supplier Page | Shop |