Name | GALNAC4S-6ST antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5944 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | GALNAC4S-6ST antibody was raised using the middle region of GALNAC4S-6ST corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS |
Purity/Format | Affinity purified |
Blocking Peptide | GALNAC4S-6ST Blocking Peptide |
Description | Rabbit polyclonal GALNAC4S-6ST antibody raised against the middle region of GALNAC4S-6ST |
Gene | CHST15 |
Supplier Page | Shop |