| Name | SFRS9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4884 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, C. elegans |
| Antigen | SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER |
| Purity/Format | Affinity purified |
| Blocking Peptide | SFRS9 Blocking Peptide |
| Description | Rabbit polyclonal SFRS9 antibody raised against the middle region of SFRS9 |
| Gene | SRSF9 |
| Supplier Page | Shop |