| Name | SNRPF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1423 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SNRPF Blocking Peptide |
| Description | Rabbit polyclonal SNRPF antibody raised against the N terminal of SNRPF |
| Gene | SNRPF |
| Supplier Page | Shop |