| Name | NDP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6210 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV |
| Purity/Format | Affinity purified |
| Blocking Peptide | NDP Blocking Peptide |
| Description | Rabbit polyclonal NDP antibody |
| Gene | NDP |
| Supplier Page | Shop |