| Name | P2RX4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5172 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | P2RX4 antibody was raised using the N terminal of P2RX4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW |
| Purity/Format | Affinity purified |
| Blocking Peptide | P2RX4 Blocking Peptide |
| Description | Rabbit polyclonal P2RX4 antibody raised against the N terminal of P2RX4 |
| Gene | P2RX4 |
| Supplier Page | Shop |