HAX1 antibody

Name HAX1 antibody
Supplier Fitzgerald
Catalog 70R-2546
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
Purity/Format Affinity purified
Blocking Peptide HAX1 Blocking Peptide
Description Rabbit polyclonal HAX1 antibody raised against the middle region of HAX1
Gene HAX1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.